Skip to Content
Merck
All Photos(1)

Key Documents

HPA012384

Sigma-Aldrich

Anti-SLC29A1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Equilibrative NBMPR-sensitive nucleoside transporter, Anti-Equilibrative nitrobenzylmercaptopurine riboside-sensitive nucleoside transporter, Anti-Equilibrative nucleoside transporter 1, Anti-Nucleoside transporter, es-type, Anti-Solute carrier family 29 member 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:500- 1:1000

immunogen sequence

RLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SLC29A1(2030)

General description

Rabbit polyclonal anti-SLC29A1 antibody reacts with human solute carrier family 29 member 1/equilibrative nucleoside transporter 1.
Solute carrier family 29 member 1/equilibrative nucleoside transporter 1 (SLC29A1) is a transmembrane glycoprotein found in cell plasma and mitochondrial membranes where it mediates the flux of nucleosides. SLC29A1 functions as a nucleoside equilibrative transporter.

Immunogen

Equilibrative nucleoside transporter 1 recombinant protein epitope signature tag (PrEST)

Application

Rabbit polyclonal anti-SLC29A1 antibody is used to tag solute carrier family 29 member 1/equilibrative nucleoside transporter 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of solute carrier family 29 member 1/equilibrative nucleoside transporter 1 processes that involve the flux of nucleosides including cytotoxic nucleosides important as chemotherapeutics.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72508

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Shahid Rehan et al.
Biochimica et biophysica acta. Biomembranes, 1859(5), 1059-1065 (2017-03-04)
The human equilibrative nucleoside transporter-1 (hENT1) is important for the entry of anti-cancer and anti-viral nucleoside analog therapeutics into the cell, and thus for their efficacy. Understanding of hENT1 structure-function relationship could assist with development of nucleoside analogs with better

Articles

Drug Transport

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service