WH0003428M3

Monoclonal Anti-IFI16 antibody produced in mouse

clone 2E3, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-IFNGIP1, Anti-PYHIN2, Anti-interferon, gamma-inducible protein 16
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 2E3, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2bκ
• GenBank-Hinterlegungsnummer: BC017059
• UniProt-Hinterlegungsnummer: Q16666
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... IFI16(3428)

Beschreibung

Allgemeine Beschreibung

IFI16 (γ-interferon-inducible protein 16) belongs to the pyrin superfamily and HIN-200 family (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeat). This gene is expressed at high levels in endothelial cells and squamous stratified epithelia. It is found in the nuclei of lymphocytes in the spleen, thymus, lymph nodes, palatine tonsil and non-lymphoid tissues including trachea, gastrointestinal tract, skin and testis. IFI16 has a DNA binding domain, a transcriptional regulatory domain, DAPIN (domain in apoptosis and interferon response) domain associated with interferon (IFN) response and BRCA1 binding domain (breast cancer tumor suppressor protein). This gene is located on human chromosome 1q23.

This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. (provided by RefSeq)

Immunogen

IFI16 (AAH17059, 630 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF

Biochem./physiol. Wirkung

IFI16 (γ-interferon-inducible protein 16) modulates p53-mediated gene transcription. It acts as a potent transcriptional repressor. IFI16 provides resistance against genital herpes.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)