Direkt zum Inhalt
Merck

HPA035248

Sigma-Aldrich

Anti-IDH1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Idh1 Antibody, Idh1 Antibody - Anti-IDH1 antibody produced in rabbit, Anti-isocitrate dehydrogenase 1 (NADP+), soluble

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human, mouse, rat

Erweiterte Validierung

RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Methode(n)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

Immunogene Sequenz

FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... IDH1(3417)

Allgemeine Beschreibung

1DH1 has a C-terminal peroxisomal targeting sequence and has two Rossmann fold units. It also possesses α /β sandwich structure and clasp domain further taking up staked parallel β-sheets fold.
The gene IDH1 (isocitrate dehydrogenase (NADP) 1 cytosolic) is mapped to human chromosome 2q33. The protein is present in the cytoplasm and peroxisomes.

Immunogen

isocitrate dehydrogenase 1 (NADP+), soluble recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-IDH1 antibody produced in rabbit has been used in western blotting.
Anti-IDH1 antibody produced in rabbit has been used in immunohistochemistry.

Biochem./physiol. Wirkung

IDH1 (isocitrate dehydrogenase (NADP) 1 cytosolic) participates in the TCA (tricarboxylic acid) cycle. It is responsible for the formation of α-ketoglutarate (αKG) by oxidative decarboxylation of isocitrate, thereby resulting in the generation of NADPH (nicotinamide adenine dinucleotide phosphate). IDH1 helps in glucose sensing, glutamine metabolism, lipogenesis and controlling cellular redox condition. In presence of hypoxia, it results in reductive carboxylation of αKG to form acetyl-CoA, which is needed for lipid synthesis. In mouse model, overexpression of the IDH1 gene causes obesity, fatty liver and hyperlipidemia. Mutations in this gene are associated with glioblastoma multiforme and acute myeloid leukemia.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST79089

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Analysenzertifikate (COA)

Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Droplet digital polymerase chain reaction for DNMT3A and IDH1/2 mutations to improve early detection of acute myeloid leukemia relapse after allogeneic hematopoietic stem cell transplantation.
Brambati C, et al.
Haematologica, 101, e157-e161 (2016)
Metformin sensitizes endometrial cancer cells to chemotherapy through IDH1-induced Nrf2 expression via an epigenetic mechanism
Bai M, et al.
Oncogene, 37(42), 5666-5681 (2018)
Do Long-Term Survivor Primary Glioblastoma Patients Harbor IDH1 Mutations?
Sarmiento JM, et al.
Journal of Neurological Surgery. Part A, Central European Neurosurgery, 77, 195-200 (2016)
Isocitrate dehydrogenase mutations in gliomas.
Waitkus MS, et al.
Neuro-Oncology, 18, 16-26 (2016)
Structures of human cytosolic NADP-dependent isocitrate dehydrogenase reveal a novel self-regulatory mechanism of activity
Xu X, et al.
The Journal of Biological Chemistry, 279(32), 33946-33957 (2004)

Artikel

Information on fatty acid synthesis and metabolism in cancer cells. Learn how proliferatively active cells require fatty acids for functions such as membrane generation, protein modification, and bioenergetic requirements. These fatty acids are derived either from dietary sources or are synthesized by the cell.

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.