HPA022040
Anti-RUNX2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(e):
Anti-Acute myeloid leukemia 3 protein, Anti-CBF-alpha-1, Anti-Core-binding factor subunit alpha-1, Anti-OSF-2, Anti-Oncogene AML-3, Anti-PEA2-alpha A, Anti-PEBP2-alpha A, Anti-Polyomavirus enhancer-binding protein 2 alpha A subunit, Anti-Runt-related transcription factor 2, Anti-SL3-3 enhancer factor 1 alpha A subunit, Anti-SL3/AKV core-binding factor alpha A subunit
Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise
Alle Fotos(8)
About This Item
Empfohlene Produkte
Biologische Quelle
rabbit
Konjugat
unconjugated
Antikörperform
affinity isolated antibody
Antikörper-Produkttyp
primary antibodies
Klon
polyclonal
Produktlinie
Prestige Antibodies® Powered by Atlas Antibodies
Form
buffered aqueous glycerol solution
Speziesreaktivität
human
Erweiterte Validierung
RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
Methode(n)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
Immunogene Sequenz
LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
UniProt-Hinterlegungsnummer
Anwendung(en)
research pathology
Versandbedingung
wet ice
Lagertemp.
−20°C
Posttranslationale Modifikation Target
unmodified
Angaben zum Gen
human ... RUNX2(860)
Allgemeine Beschreibung
Runt-related transcription factor 2/acute myeloid leukemia 3 protein (RUNX2, AML-3) belongs to Runt DNA-binding domain transcription factor family. RUNX2 gene is mapped to human chromosome 6p21.1 RUNX2 possesses the Runt domain, nuclear localization signal (NLS), the nuclear matrix targeting signal (NMTS) and a C-terminal VWRPY sequence. It also has two additional domains, one being the N-terminal glutamine-alanine (QA) repeats and the other a C-terminal proline/serine/threonine (PST) rich tract. RUNX2 exists in two isoforms. The isoform 1 is expressed in osteoblasts and the isoform 2 is distributed in mesenchymal condensations and mature chondrocytes.
Runt-related transcription factor 2/acute myeloid leukemia 3 protein (RUNX2, AML-3) is a Runt DNA-binding domain transcription factor that facilitates osteoblast differentiation and skeletal morphogenesis.
Spezifität
Rabbit polyclonal anti-RUNX2 antibody reacts with human runt-related transcription factor 2/Acute myeloid leukemia 3 protein.
Immunogen
Runt-related transcription factor 2 recombinant protein epitope signature tag (PrEST)
Anwendung
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-RUNX2 antibody produced in rabbit has been used in immunohistochemistry and immunofluorescence.
Rabbit polyclonal anti-RUNX2 antibody is used to tag Runt-related transcription factor 2/Acute myeloid leukemia 3 protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of runt-related transcription factor 2/Acute myeloid leukemia 3 protein in osteoblast differentiation and skeletal morphogenesis.
Biochem./physiol. Wirkung
Runt-related transcription factor 2/ acute myeloid leukemia 3 protein (RUNX2, AML-3) mediates osteoblast differentiation and skeletal morphogenesis. It promotes mesenchymal cell differentiation in osteoblasts and its maturation. Elevated levels of RUNX2 is observed in bone?metastatic cancers. The post-translational modifications like phosphorylation, methylation, glycosylation and ubiquitination in the RUNX2 modulates osteogenesis. Mutations in the RUNX2 gene leading to loss of function is implicated in cleidocranial dysplasia (CCD). The levels of RUNX2 is elevated in osteosarcoma.
Leistungsmerkmale und Vorteile
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Verlinkung
Corresponding Antigen APREST86701
Physikalische Form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Rechtliche Hinweise
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Sie haben nicht das passende Produkt gefunden?
Probieren Sie unser Produkt-Auswahlhilfe. aus.
Lagerklassenschlüssel
10 - Combustible liquids
WGK
WGK 1
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Analysenzertifikate (COA)
Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Bianca Gazieri Castelucci et al.
PloS one, 13(4), e0195304-e0195304 (2018-04-06)
Animal models commonly serve as a bridge between in vitro experiments and clinical applications; however, few physiological processes in adult animals are sufficient to serve as proof-of-concept models for cartilage regeneration. Intriguingly, some rodents, such as young adult mice, undergo
Greg Holmes et al.
Gene expression patterns : GEP, 17(1), 16-25 (2014-12-17)
Sutures, where neighboring craniofacial bones are separated by undifferentiated mesenchyme, are major growth sites during craniofacial development. Pathologic fusion of bones within sutures occurs in a wide variety of craniosynostosis conditions and can result in dysmorphic craniofacial growth and secondary
Midface and upper airway dysgenesis in FGFR2-related craniosynostosis involves multiple tissue-specific and cell cycle effects
Holmes G, et al.
Development, 145(19), e0201492-e0201492 (2018)
Time-dependent regulation of morphological changes and cartilage differentiation markers in the mouse pubic symphysis during pregnancy and postpartum recovery
Castelucci BG, et al.
Testing, 13(4), e0195304-e0195304 (2018)
Neus Martínez-Abadías et al.
Disease models & mechanisms, 6(3), 768-779 (2013-03-23)
Apert syndrome is a congenital disorder characterized by severe skull malformations and caused by one of two missense mutations, S252W and P253R, on fibroblast growth factor receptor 2 (FGFR2). The molecular bases underlying differential Apert syndrome phenotypes are still poorly
Artikel
Mesenchymal stem cell markers and antibodies suitable for investigating targets in fibroblasts, chondrocytes, adipocytes, osteoblasts, and muscle cells.
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung.