HPA006458

Anti-TOP2A antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Synonym(e): Anti-TOP2A_HUMAN Isoform 2 of P11388 - Homo sapiens
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA006458

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: DASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKG
• UniProt-Hinterlegungsnummer: P11388
• Anwendung(en): research pathology
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TOP2A(7153)

Beschreibung

Allgemeine Beschreibung

TOP2A (topoisomerase (DNA) IIα) is a nuclear enzyme, which has a molecular weight of 170kDa. This gene is localized to human chromosome 17q21-q22. Along with TOP2β, it forms the two isoforms of TOP2 enzyme. It is a ubiquitously expressed homodimeric protein. Its N-terminal contains the ATP-binding and hydrolysis sites. It also contains the catalytic central domain, and the C-terminal containing the DNA-recognition site.

Immunogen

TOP2A_HUMAN Isoform 2 of P11388 - Homo sapiens recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-TOP2A antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

TOP2A (topoisomerase (DNA) IIα) regulates chromosome segregation, progression of cell cycle and the topological structure of DNA. It acts as a target of multiple drugs such as, anthracyclines (doxorubicin, epirubicin) and epipodophyllotoxins (etoposide, teniposide). In HER2 (human epithelial growth factor receptor-2)-amplified breast cancer, this gene is also amplified. This gene is up-regulated in multiple cancers such as, hepatocellular carcinoma (HCC), prostate and gastric cancer. In renal cell carcinoma patients, overexpression of this gene is linked to poor survival rates.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST70242

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable