HPA005724

Anti-VASP antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): VASP Antibody - Anti-VASP antibody produced in rabbit, Vasp Antibody, Anti-VASP, Anti-Vasodilator-stimulated phosphoprotein
• MDL-Nummer: MFCD01634352
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA005724

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human, rat, mouse
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• Immunogene Sequenz: PKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVK
• UniProt-Hinterlegungsnummer: P50552
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... VASP(7408)

Beschreibung

Allgemeine Beschreibung

VASP gene is located on human chromosome 19q13.2.

Vasodilator-stimulated phosphoprotein (VASP) is an adhesion protein. It belongs to the conserved family of actin regulatory proteins made up of an EVH1 domain, an EVH2 domain and a proline-rich central region.

Immunogen

Vasodilator-stimulated phosphoprotein recombinant protein epitope signature tag (PrEST)

Anwendung

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)
Western Blotting (1 paper)

Biochem./physiol. Wirkung

Vasodilator-stimulated phosphoprotein (VASP) associates with the barbed ends of actin filaments and takes part in the antagonize filament capping, by interacting with the capping protein (CapZ). It reduces the density of Arp2/3-dependent actin filament branches and bind profilin at sites of actin polymerization. The N-terminal EVH1 domain interacts with proteins associated with focal adhesion plaques. The central proline-rich region interacts with SH3 domains and profilins. The C-terminal EVH2 domain aids in the tetramerization of actin by interacting with polymerized actin fibres.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST70083

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)