HPA002951

Anti-CSPG4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Chondroitin sulfate proteoglycan 4 precursor, Anti-Chondroitin sulfate proteoglycan NG2, Anti-Melanoma chondroitin sulfate proteoglycan, Anti-Melanoma-associated chondroitin sulfate proteoglycan
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA002951
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: recombinant expression; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL
• UniProt-Hinterlegungsnummer: Q6UVK1
• Anwendung(en): research pathology
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CSPG4(1464)

Beschreibung

Allgemeine Beschreibung

Chondroitin sulfate proteoglycan 4 (CSPG4) belongs to the chondroitin sulfate group of glycosaminoglycans (GAGs) and is a type 1 transmembrane protein that harbors glycosylation. The CSPG4 gene is mapped to human chromosome15q24.2. It is an N-linked glycoprotein with a large extracellular domain, transmembrane domain and a cytoplasmic tail. The extracellular domain comprises two laminin G-type subdomains and a middle domain with CSPG4 specific repeats.

Immunogen

Chondroitin sulfate proteoglycan 4 precursor recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-CSPG4 antibody produced in rabbit has been used in fluorescent immunohistochemistry(1:200), 1:250 and immunocytochemistry.

Biochem./physiol. Wirkung

Chondroitin sulfate proteoglycan 4 (CSPG4) is implicated in the pathogenesis of glioma proliferation. It may be involved in the regulation of the neural network, oligodendrocyte formation, and epithelial stem cell homeostasis. Missense mutations in the CSPG4 gene may correlate with white matter integrity impairment and schizophrenia development. It regulates cytoskeletal reorganization and epithelial to mesenchymal transition (EMT) in melanomas. CSPG4 may serve as a potential target for cancer therapies.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST86400

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)