AV32256

Anti-NR2F6 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-Nuclear receptor subfamily 2, group F, member 6
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 43 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_005225
• UniProt-Hinterlegungsnummer: P10588
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NR2F6(2063)

Beschreibung

Allgemeine Beschreibung

NR2F6 is a nuclear receptor that functions as PKC substrate. This receptor is known to regulate the responses of CD4+ T cell activation. Rabbit Anti-NR2F6 (AB1) antibody recognizes canine, human, mouse, and rat NR2F6.

Immunogen

Synthetic peptide directed towards the N terminal region of human NR2F6

Anwendung

Rabbit Anti-NR2F6 (AB1) antibody can be used for western blot assays at a concentration of 0.1-5.0μg/ml.

Biochem./physiol. Wirkung

NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily

Sequenz

Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable