WH0286749M1

Monoclonal Anti-SALF antibody produced in mouse

clone 5F12, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-stoned B/TFIIA-alpha/beta-like factor
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 5F12, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_172311
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... STON1-GTF2A1L(286749)

Descrizione

Descrizione generale

The STON1-GTF2A1L mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring STON1 and GTF2A1L genes. This rare transcript encodes a fusion protein composed of greater than 95% each of the individual elements, stonin 1 and general transcription factor IIA, 1-like. The significance of this co-transcribed mRNA and the function of its protein product have not yet been determined. (provided by RefSeq)

Immunogeno

SALF (NP_758515, 141 a.a. ~ 249 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDCAFSSPFWKDEGSDSHFTLDPPGSKKMFSSRNKEMPIDQKSLNKCSLNYICEKLEHLQSAENQDSLRSLS

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)