WH0084107M1

Monoclonal Anti-ZIC4 antibody produced in mouse

clone 4B1, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-FLJ42609, Anti-FLJ45833, Anti-Zic family member 4
• Codice UNSPSC: 12352203
• NACRES: NA.41
• Coniugato: unconjugated
• application: ELISA; IF; WB
• Clone: 4B1, monoclonal
• Reattività contro le specie: mouse
• tecniche: ELISA: suitable; immunofluorescence: suitable; western blot: 1-5 μg/mL

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 4B1, monoclonal
• Stato: buffered aqueous solution
• Reattività contro le specie: mouse
• tecniche: ELISA: suitable; immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_032153
• N° accesso UniProt: Q61467
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ZIC4(84107)

Descrizione

Descrizione generale

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function. (provided by RefSeq)

Immunogeno

ZIC4 (NP_115529, 249 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQV

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)