Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

WH0054815M1

Sigma-Aldrich

Monoclonal Anti-GATAD2A antibody produced in mouse

clone 3F3, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-FLJ20085, Anti-GATA zinc finger domain containing 2A, Anti-p66alpha

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.43

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

3F3, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... GATAD2A(54815)

Descrizione generale

GATAD2A (GATA zinc finger domain containing 2A), a 68kDa protein, is a component of multi-subunit protein Mi-2/NuRD (Nucleosome Remodeling Deacetylase) complex. The Mi-2/NuRD complex is essential for the ATP-dependent chromatin remodeling and histone deacetylase activities. It also performs in the methylation dependent transcriptional repression by guiding repressors to the chromatin. The gene encoding GATAD2A is localized on human chromosome 19p13.11. GATAD2A interacts with the histone tail in vitro and acetylates histone tails.

Immunogeno

GATAD2A (NP_060130, 26 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVP

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

nwg

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

A Drosophila functional evaluation of candidates from human genome-wide association studies of type 2 diabetes and related metabolic traits identifies tissue-specific roles for dHHEX
Jay Pendse
BMC Genomics, 14 (2013)
p66alpha and p66beta of the Mi-2/NuRD complex mediate MBD2 and histone interaction.
Marc Brackertz
Nucleic Acids Research, 34 (2006)
NURD, a novel complex with both ATP-dependent chromatin-remodeling and histone deacetylase activities
Y Xue
Molecular Cell, 2 (1999)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.