Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

WH0023462M1

Sigma-Aldrich

Monoclonal Anti-HEY1 antibody produced in mouse

clone 3B3, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-CHF2, Anti-HERP2, Anti-HESR1, Anti-HRT1, Anti-hairy/enhancer-of-split related with YRPW motif 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

3B3, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... HEY1(23462)

Descrizione generale

Hey1/HESR1 (hes related family bHLH transcription factor with YRPW motif 1) is a basic helix-loop-helix transcription factor that belongs to the HES family. It is located on human chromosome 8q21.
This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Immunogeno

HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG

Azioni biochim/fisiol

Hey1/HESR1 (hes related family bHLH transcription factor with YRPW motif 1) participates in the progression of brain tumors. HESR1 is required for the initiation of a tubular network and to maintain mature and quiescent blood vessels. Overexpression of Hey1 results in osteopenia and chondrocyte hypertrophy in bone.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

A role for the transcription factor HEY1 in glioblastoma
Hulleman E, et al.
Journal of Cellular and Molecular Medicine, 13(1), 136-146 (2009)
Ubiquitous overexpression of Hey1 transcription factor leads to osteopenia and chondrocyte hypertrophy in bone
Salie R, et al.
Bone, 46(3), 680-694 (2010)
Protective effects of transcription factor HESR1 on retinal vasculature
Li B, et al.
Microvascular Research, 72(3), 146-152 (2006)

Global Trade Item Number

SKUGTIN
WH0023462M1-100UG4061832743981

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.