WH0010841M1

Monoclonal Anti-FTCD antibody produced in mouse

clone 3A4, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-LCHC1, Anti-formiminotransferase cyclodeaminase
• Numero MDL: MFCD00164605
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3A4, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_206965
• N° accesso UniProt: O95954
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FTCD(10841)

Descrizione

Descrizione generale

FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.(supplied by OMIM) Formimidoyltransferase cyclodeaminase (FTCD) gene is localized in human fetal and adult liver. The gene is located on human chromosome 21q22.3.

Immunogeno

FTCD (NP_996848, 440 a.a. ~ 541 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Applicazioni

Monoclonal Anti-FTCD antibody produced in mouse has been used in indirect immunofluorescence staining, immunohistochemistry and immunocytochemistry.

Azioni biochim/fisiol

Formimidoyltransferase cyclodeaminase (FTCD) deficiency is associated with formiminoglutamic aciduria. FTCD is considered as a therapeutic target for hepatocellular carcinoma (HCC). Mutations in FTCD is linked to glutamate formiminotransferase deficiency.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)