WH0008851M1

Monoclonal Anti-CDK5R1 antibody produced in mouse

clone 4G11, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-CDK5P35, Anti-CDK5R, Anti-MGC33831, Anti-NCK5A, Anti-cyclin-dependent kinase 5, regulatory subunit 1 (p35), Anti-p23, Anti-p25, Anti-p35, Anti-p35nck5a
• Numero MDL: MFCD00211612
• Codice UNSPSC: 12352203
• NACRES: NA.43

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 4G11, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: BC020580
• N° accesso UniProt: Q15078
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CDK5R1(8851)

Descrizione

Descrizione generale

The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer′s disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer′s disease. (provided by RefSeq)

Immunogeno

CDK5R1 (AAH20580, 208 a.a. ~ 307 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)