WH0007291M1

Monoclonal Anti-TWIST1 antibody produced in mouse

clone 3E11, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-ACS3, Anti-BPES2, Anti-BPES3, Anti-SCS, Anti-TWIST, Anti-twist homolog 1 (acrocephalosyndactyly 3; Saethre-Chotzen syndrome) (Drosophila)
• Numero MDL: MFCD08705531
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3E11, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: NM_000474
• N° accesso UniProt: Q15672
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TWIST1(7291)

Descrizione

Descrizione generale

Twist family bHLH transcription factor 1 (TWIST1) is a basic helix-loop-helix transcription factor and the gene encoding it is localized on human chromosome 7p21.1.

Immunogeno

TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

Azioni biochim/fisiol

Twist family bHLH transcription factor 1 (TWIST1) has a role in the determination of cell lineage and differentiation during embryogenesis. During the development of neural crest, it is also involved in modulating cell movement and tissue reorganization. Mutations in the TWIST1 gene have been associated with Saethre-Chotzen syndrome (4) and the protein is also linked to various cancers.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)