WH0005728M1

Monoclonal Anti-PTEN antibody produced in mouse

clone 2G9, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-BZS, Anti-MGC11227, Anti-MHAM, Anti-MMAC1, Anti-PTEN1, Anti-TEP1, Anti-phosphatase and tensin homolog (mutated in multiple advanced cancers 1)
• Numero MDL: MFCD02097285
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2G9, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: BC005821
• N° accesso UniProt: P60484
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PTEN(5728)

Descrizione

Descrizione generale

Phosphatase and tensin homolog (PTEN) is a tumor-suppressor gene. It encodes for a phosphatase which possesses a tensin-like domain, a catalytic domain and a 220-amino acid carboxy-terminal region. The PTEN gene is localized on human chromosome 10q23.3.

Immunogeno

PTEN (AAH05821, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL

Applicazioni

Monoclonal Anti-PTEN antibody produced in mouse has been used in Western Blotting.

Azioni biochim/fisiol

Phosphatase and tensin homolog (PTEN) is a negative regulator of the phosphoinositide 3-kinase (PI3K) pathway. It de-phosphorylates phosphatidylinositol-[3, 4, 5]-tri-phosphate (PIP3). PTEN also has roles in cell growth, proliferation, control of cell cycle and apoptosis. It has been associated with gastric and breast cancers.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)