Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

WH0003340M1

Sigma-Aldrich

Monoclonal Anti-NDST1 antibody produced in mouse

clone 1G10, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-HSST, Anti-N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1, Anti-NST1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

1G10, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... NDST1(3340)

Descrizione generale

NDST1 (N-deacetylase and N-sulfotransferase 1) is a bifunctional enzyme that has both N-deacetylase and N-sulfotransferase activities. This gene is located on human chromosome 5q33.

Immunogeno

NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI

Azioni biochim/fisiol

The enzyme coded by NDST1 (N-deacetylase and N-sulfotransferase 1) gene participates in the first step in the production of heparan sulfate chains and proteoglycans. This enzyme also plays a major role in generating the GlcNS (N-sulfo glucosamine) residues.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

WT1 mutation and 11P15 loss of heterozygosity predict relapse in very low-risk wilms tumors treated with surgery alone: a children's oncology group study
Perlman EJ, et al.
Journal of Clinical Oncology, 29(6), 698-703 (2011)
Role of Deacetylase Activity of N-Deacetylase/N-Sulfotransferase 1 in Forming N-Sulfated Domain in Heparan Sulfate
Dou W, et al.
The Journal of Biological Chemistry, 290(33), 20427-20437 (2015)
A girl with developmental delay, ataxia, cranial nerve palsies, severe respiratory problems in infancy-Expanding NDST1 syndrome
Armstrong L, et al.
American Journal of Medical Genetics. Part A (2017)

Articoli

Glycosaminoglycans are large linear polysaccharides constructed of repeating disaccharide units.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.