WH0003043M1

Monoclonal Anti-HBB antibody produced in mouse

clone 2H3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-CD113tC, Anti-HBD, Anti-hemoglobin, Anti-hemoglobin, beta
• Numero MDL: MFCD00162411
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2H3, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: ELISA: suitable; capture ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG3κ
• N° accesso Genebanck: BC007075
• N° accesso UniProt: P68871
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... HBB(3043)

Descrizione

Descrizione generale

HBB (hemoglobin subunit β) codes for a β-globin that consists of three exons. This gene is located on human chromosome 11p15. HBB is a serum protein that belongs to the histone-like protein family.

The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5′-epsilon -- gamma-G -- gamma-A -- delta -- beta--3′. (provided by RefSeq)

Immunogeno

HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH

Azioni biochim/fisiol

HBB (hemoglobin subunit β) participates in oxygen transport from the lung to various peripheral tissues. Mutation in HBB result in Sickle cell disease (SCD). Overexpression of HBB has been observed in patients with periodontal disease.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)