SAB5702648

Anti-Annexin A5/Annexin V Antibody, clone 9A5M8, Rabbit Monoclonal

• Sinonimo/i: ANX5, ENX2, HEL-S-7, PP4, RPRGL3
• Codice UNSPSC: 12352203
• NACRES: NA.46
• Clone: 9A5M8, monoclonal
• application: WB
• Reattività contro le specie: human, rat, rat
• tecniche: western blot: 1:500 - 1:2000

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 9A5M8, monoclonal
• Stato: liquid
• PM: 36 kDa
• Reattività contro le specie: human, rat, rat
• Concentrazione: 0.5 mg/mL
• tecniche: western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: IEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
• N° accesso UniProt: P08758
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ANXA5(308)

Descrizione

Descrizione generale

The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq, Jul 2008]

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 221-320 of human Annexin A5/Annexin A5/Annexin V (P08758).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1