SAB5702062

Anti-HDAC4 Antibody, clone 9A6E2, Rabbit Monoclonal

• Sinonimo/i: AHO3, BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA
• Codice UNSPSC: 12352203
• NACRES: NA.46
• Clone: 9A6E2, monoclonal
• application: WB
• Reattività contro le specie: human
• tecniche: western blot: 1:500 - 1:2000

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 9A6E2, monoclonal
• Stato: liquid
• PM: 140 kDa
• Reattività contro le specie: human
• Concentrazione: 0.39 mg/mL
• tecniche: western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQL
• N° accesso UniProt: P56524
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... HDAC4(9759)

Descrizione

Descrizione generale

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3. [provided by RefSeq, Jul 2008]

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC4 (P56524).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1