Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

SAB2105061

Sigma-Aldrich

Anti-OTUD6B antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-CGI-77, Anti-duba5

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

37 kDa

Reattività contro le specie

dog, rat, horse, human, guinea pig, mouse, bovine, goat, rabbit

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NM_016023

N° accesso UniProt

Q8N6M0

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... OTUD6B(51633)

Descrizione generale

The gene OTUD6B (OTU domain containing 6B) is mapped to human chromosome 8q21. The encoded protein belongs to the OTU (ovarian tumor) family of proteins. OTUD6B is a deubiquitinating enzyme which can be induced by cytokines.

Immunogeno

Synthetic peptide directed towards the middle region of human OTUD6B

Azioni biochim/fisiol

In B lymphocytes, OTUD6B (OTU domain containing 6B) negatively regulates cell proliferation. In transgenic mouse (TgMMTV-neu) model, OTUD6B autoantibodies were detected prior to the development of breast cancer and might be used for the early human cancer detection.

Sequenza

Synthetic peptide located within the following region: EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Zhongping Xu et al.
PloS one, 6(1), e14514-e14514 (2011-01-27)
Deubiquitinating enzymes (DUBs) are important regulators of cell proliferation. Here we identified a functional deubiquitinating enzyme, ovarian tumor domain-containing 6B (OTUD-6B). Mutation of the conserved Cys residue abolished its deubiquitinating activity in vitro. Otud-6b expression was induced with cytokine stimulation
Jianning Mao et al.
Journal of translational medicine, 12, 121-121 (2014-06-03)
The use of autoantibodies for the early detection of breast cancer has generated much interest as antibodies can be readily assayed in serum when antigen levels are low. Ideally, diagnostic autoantibodies would be identified in individuals who harbored pre-invasive disease/high
Sehrish Rafique et al.
Genome biology, 16, 145-145 (2015-08-04)
Epigenetic changes are being increasingly recognized as a prominent feature of cancer. This occurs not only at individual genes, but also over larger chromosomal domains. To investigate this, we set out to identify large chromosomal domains of epigenetic dysregulation in

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.