Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB2104456

Sigma-Aldrich

Anti-PGM1 antibody produced in rabbit

affinity isolated antibody

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

61 kDa

Reattività contro le specie

rabbit, mouse, guinea pig, human, rat

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NM_002633

N° accesso UniProt

P36871

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PGM1(5236)

Categorie correlate

Descrizione generale

The gene PGM1 (phosphoglucomutase 1) is mapped to human chromosome 1p31. It belongs to the phosphohexose mutase family of proteins.

Immunogeno

Synthetic peptide directed towards the middle region of human PGM1

Azioni biochim/fisiol

PGM1 (phosphoglucomutase 1) plays a crucial role in glucose homeostasis and is responsible for regulating the switch between glycolysis and gluconeogenesis. It is mainly involved in the reversible conversion of glucose 1-phosphate and glucose 6-phosphate. It also participates in protein N-glycosylation. Deficiency of PGM1 has been associated with metabolic disorders, such as hepatopathy, dilated cardiomyopathy and exercise intolerance.

Sequenza

Synthetic peptide located within the following region: ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
QC27375

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Eunju Bae et al.
FEBS letters, 588(17), 3074-3080 (2014-06-22)
Phosphoglucomutase (PGM)1 catalyzes the reversible conversion reaction between glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P). Although both G-1-P and G-6-P are important intermediates for glucose and glycogen metabolism, the biological roles and regulatory mechanisms of PGM1 are largely unknown. In this study
Naheed A Rana et al.
Human molecular genetics, 13(24), 3089-3102 (2004-10-29)
The distribution of linkage disequilibrium (LD) in the human genome has important consequences for the design of experiments that infer susceptibility genes for complex disease using association studies. Recent studies have shown a non-random distribution of human meiotic recombination associated
Yingying Lee et al.
The Journal of biological chemistry, 289(46), 32010-32019 (2014-10-08)
Recent studies have identified phosphoglucomutase 1 (PGM1) deficiency as an inherited metabolic disorder in humans. Affected patients show multiple disease phenotypes, including dilated cardiomyopathy, exercise intolerance, and hepatopathy, reflecting the central role of the enzyme in glucose metabolism. We present

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.