SAB2102776

Anti-ZFYVE1 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-DFCP1, Anti-KIAA1589, Anti-TAFF1, Anti-ZNFN2A1, Anti-Zinc finger, FYVE domain containing 1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 87 kDa
• Reattività contro le specie: dog, human, guinea pig, horse, mouse, rat, rabbit, bovine
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso UniProt: Q9HBF4
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ZFYVE1(53349)

Descrizione

Descrizione generale

Zinc finger FYVE-type containing 1 (ZFYVE1) encodes a 777 amino acid protein, which consists a N terminal Cys-His cluster homologous to zinc finger domains and two zinc-binding FYVE domains at the C terminal. It also contains an ATP/GTP binding site. ZFYVE1 gene is located on human chromosome 14q22-q24.

Immunogeno

Synthetic peptide directed towards the C terminal region of human ZFYVE1

Azioni biochim/fisiol

ZFYVE1 contains two zinc-binding FYVE domains in tandem. This protein binds to phosphatidylinositol-3-phosphate (PtdIns3P) through its FYVE-type zinc finger. It displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes.The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains two zinc-binding FYVE domains in tandem. This protein displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes. Zinc finger FYVE-type containing 1 (ZFYVE1) organizes the endoplasmic reticulum around the phagophore to form a cradle like structure, which is called as an omegasome.

Sequenza

Synthetic peptide located within the following region: VCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable