SAB2102463

Anti-TMEM173 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-FLJ38577, Anti-Transmembrane protein 173
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 42 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso UniProt: Q86WV6
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TMEM173(340061)

Descrizione

Immunogeno

Synthetic peptide directed towards the middle region of human TMEM173

Azioni biochim/fisiol

TMEM173 acts as a facilitator of innate immune signaling. It is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. TMEM173 may be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons.It also may be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). TMEM173 mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway.

Sequenza

Synthetic peptide located within the following region: DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable