Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

SAB2102181

Sigma-Aldrich

Anti-SLC24A6 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-FLJ22233, Anti-NCKX6, Anti-NCLX, Anti-Solute carrier family 24, member 6

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

64 kDa

Reattività contro le specie

human, rabbit, rat, guinea pig, bovine, mouse, dog, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso UniProt

Q6J4K2

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SLC24A6(80024)

Descrizione generale

Solute carrier family 24, member 6 (SLC24A6) or solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 (SLC8B1) gene codes for Na+/Ca2+/Li+ exchanger (NCLX). NCLX belongs to the Na+/Ca2+ exchanger (NCX) family. This protein is expressed at a high level in the brain, skeletal and heart muscle, pancreas β-cells, and lymphocyte B-cells. NCLX contains a small regulatory domain that has a phosphorylation site and lacks Ca2+ binding domains (CBDs).

Immunogeno

Synthetic peptide directed towards the middle region of human SLC24A6

Applicazioni

Anti-SLC24A6 antibody produced in rabbit has been used in western blotting(1:250).

Azioni biochim/fisiol

Solute carrier family 8, member B1 (SLC8B1)/Na+/Ca2+/Li+ exchanger (NCLX) helps in the transportation of the sodium or lithium-ion in exchange for the calcium ion.

Sequenza

Synthetic peptide located within the following region: SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Marko Kostic et al.
Seminars in cell & developmental biology, 94, 59-65 (2019-01-19)
Mitochondrial Ca2+ transient is the earliest discovered organellar Ca2+ signaling pathway. It consist of a Ca2+ influx, mediated by mitochondrial Ca2+ uniporter (MCU), and mitochondrial Ca2+ efflux mediated by a Na+/Ca2+ exchanger (NCLX). Mitochondrial Ca2+ signaling machinery plays a fundamental
Marko Kostic et al.
Cell reports, 25(12), 3465-3475 (2018-12-20)
Calcium is a key regulator of mitochondrial function under both normal and pathological conditions. The mechanisms linking metabolic activity to mitochondrial Ca2+ signaling remain elusive, however. Here, by monitoring mitochondrial Ca2+ transients while manipulating mitochondrial membrane potential (ΔΨm), we found
Olha M Koval et al.
Science signaling, 12(579) (2019-05-02)
The role of the mitochondrial Ca2+ uniporter (MCU) in physiologic cell proliferation remains to be defined. Here, we demonstrated that the MCU was required to match mitochondrial function to metabolic demands during the cell cycle. During the G1-S transition (the

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.