SAB2100630

Anti-DTL antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-CDT2, Anti-DCAF2, Anti-Denticleless homolog (Drosophila), Anti-L2DTL, Anti-RAMP
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 79 kDa
• Reattività contro le specie: mouse, guinea pig, human, dog, rat, bovine, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso UniProt: Q9NZJ0
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... DTL(51514)

Descrizione

Immunogeno

Synthetic peptide directed towards the N terminal region of human DTL

Azioni biochim/fisiol

DTL is required for CDT1 proteolysis in response to DNA damage through the CUL4-DDB1 E3 ubiquitin-protein ligase. It seems to be necessary to ensure proper cell cycle regulation of DNA replication. DTL may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. It also may play a role in cell proliferation of NT2 embryonal carcinoma cells.

Sequenza

Synthetic peptide located within the following region: VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable