Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

SAB1412123

Sigma-Aldrich

ANTI-CA1 antibody produced in mouse

clone 1E11, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

CA1, Car1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

1E11, monoclonal

Stato

buffered aqueous solution

PM

antigen 54.45 kDa

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CA1(759)

Descrizione generale

Carbonic anhydrase 1 (CA1) is a cytosolic protein, encoded by the gene mapped to human chromosome 8q21.2.[64} The encoded protein belongs to the carbonic anhydrase (CA) family. CA1 is highly expressed in blood. Its expression is also found in spinal cord motor neurons, intestinal, vascular, corneal epithelia, synovium and cardiac capillary endothelial cells.
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Variants of this gene have been described in some populations. Multiple alternatively spliced variants, encoding the same protein, have been identified. Transcript variants of CA1 utilizing alternative polyA_sites have been described in literature. (provided by RefSeq)

Immunogeno

CA1 (AAH27890, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Azioni biochim/fisiol

Carbonic anhydrase 1 (CA1) catalyzes the reversible hydration and dehydration reactions of CO2/ carbonic acid (H2CO3).[65} It plays a vital role in the transport of metal ions. In addition, it might also be involved in biomineralization and new bone formation. CA1 acts as an oncogene and leads to irregular cell calcification, apoptosis and migration in breast tumor tissues. Overexpression of the gene has been observed in serum of stage I non-small cell lung cancer (NSCLC) patients. It can be used as a potential biomarker for early diagnosis of NSCLC. Additionally, CA1 is also upregulated in amyotrophic lateral sclerosis (ALS) and is involved in motor neuron degeneration.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Dong-Bin Wang et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 37(1), 553-559 (2015-08-02)
This study aimed to identify candidate biomarkers associated with stage I non-small cell lung cancer (NSCLC). Sera from three groups, a lung cancer group (n = 11), benign control group (n = 12), and normal control group (n = 10), were collected and pooled. Protein expression
KeQiu Li et al.
Ecotoxicology and environmental safety, 105, 51-58 (2014-05-03)
Electronic waste (e-waste) disposal is a growing problem in China, and its effects on human health are a concern. To determine the concentrations of pollutants in peripheral blood and genetic aberrations near an e-waste disposal area in Jinghai, China, blood
Yabing Zheng et al.
BMC cancer, 15, 679-679 (2015-10-16)
Although mammary microcalcification is frequently observed and has been associated with poor survival in patients with breast cancer, the genesis of calcification remains unclear. Carbonic anhydrase I (CA1) has been shown to promote calcification by catalysing the hydration of CO2.
Xiaochen Liu et al.
International journal of molecular sciences, 17(11) (2016-11-04)
Carbonic anhydrase I (CA1) is the cytosolic isoform of mammalian α-CA family members which are responsible for maintaining pH homeostasis in the physiology and pathology of organisms. A subset of CA isoforms are known to be expressed and function in
Daniele Torella et al.
Journal of the American Heart Association, 3(2), e000434-e000434 (2014-03-29)
Diabetes mellitus (DM) has multifactorial detrimental effects on myocardial tissue. Recently, carbonic anhydrases (CAs) have been shown to play a major role in diabetic microangiopathy but their role in the diabetic cardiomyopathy is still unknown. We obtained left ventricular samples

Global Trade Item Number

SKUGTIN
SAB1412123-100UG4061829670276

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.