Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB1406282

Sigma-Aldrich

Anti-PPP1CB antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

MGC3672, PP-1B, PPP1CD

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

antigen ~37.2 kDa

Reattività contro le specie

human

tecniche

western blot: 1 μg/mL

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PPP1CB(5500)

Descrizione generale

Protein phosphatase 1 catalytic subunit β (PPP1CB), is encoded by the gene mapped to human chromosome 2p23.2. The protein is expressed in spines, dendrites, axon terminals, axons, and glia in the prefrontal cortex, but at higher levels in dendrites. PPP1CB is characterized with a calcineurin-like phosphoesterase domain, a metallophosphatase domain and a serine/threonine protein phosphatase domain.
The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. (provided by RefSeq)

Immunogeno

PPP1CB (NP_002700.1, 1 a.a. ~ 327 a.a) full-length human protein.

Sequence
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

Azioni biochim/fisiol

Protein phosphatase 1 catalytic subunit β (PPP1CB) plays a vital role in various cellular processes, such as cell adhesion, cell cycle, small GTPase-mediated signal transduction, protein dephosphorylation, negative regulation of transforming growth factor, regulation of glycogen catabolic process and striated muscle tissue development. In brain, PPP1CB regulates synaptic plasticity. Mutation in the gene causes intellectual disability (ID), congenital heart disease. In addition, variation in the gene expression is also associated with the development of features resembling noonan syndrome with loose anagen hair (NS-LAH).

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

A Novel Rasopathy Caused by Recurrent De Novo Missense Mutations In PPP1CB Closely Resembles Noonan Syndrome with Loose Anagen Hair
Gripp KW, et al.
American Journal of Medical Genetics. Part A, 170(9), 2237-2247 (2016)
De Novo Missense Variants in PPP1CB Are Associated with Intellectual Disabilities and Congenital Heart Disease
Ma L, et al.
Human Genetics, 135(12), 1399-1409 (2016)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.