SAB1405223

Monoclonal Anti-CPNE5 antibody produced in mouse

clone 2G4, ascites fluid

• Sinonimo/i: COPN5, CPN5, DKFZp666C234, KIAA1599
• Codice UNSPSC: 12352203
• NACRES: NA.41
• Coniugato: unconjugated
• application: ELISA (i); WB
• Clone: 2G4, monoclonal
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1:500-1:1000

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: ascites fluid
• Tipo di anticorpo: primary antibodies
• Clone: 2G4, monoclonal
• PM: antigen ~32.49 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotipo: IgG1κ
• N° accesso NCBI: NM_020939
• N° accesso UniProt: Q9HCH3
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CPNE5(57699)

Descrizione

Descrizione generale

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Sequence analysis identified multiple alternatively spliced transcript variants but their full-length natures could not be determined. (provided by RefSeq)

Immunogeno

CPNE5 (NP_065990, 393 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQD

Stato fisico

Clear solution

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable