Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

SAB1404825

Sigma-Aldrich

Monoclonal Anti-RBM14 antibody produced in mouse

clone 4E1, ascites fluid

Sinonimo/i:

COAA, DKFZp779J0927, MGC15912, MGC31756, PSP2, SIP, SYTIP1, TMEM137

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

ascites fluid

Tipo di anticorpo

primary antibodies

Clone

4E1, monoclonal

PM

antigen ~38.1 kDa

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1:500-1:1000

Isotipo

IgG2aκ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... RBM14(10432)

Immunogeno

RBM14 (AAH00488, 51 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQ

Stato fisico

Clear solution

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

11 - Combustible Solids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Kenya Kobayashi et al.
ORL; journal for oto-rhino-laryngology and its related specialties, 76(3), 137-146 (2014-07-06)
Head and neck squamous cell carcinoma of an unknown primary site (HNSCCUP) is a heterogeneous group of tumors that includes the human papillomavirus (HPV)-associated oropharyngeal squamous cell carcinoma. To investigate the relationship between HNSCCUP and HPV, we reviewed p16 overexpression
Lanea M Keller et al.
Head & neck, 36(12), 1677-1684 (2013-10-12)
The purpose of this study was to report associations between p16 status, clinicopathologic characteristics, and outcomes for head and neck squamous cell carcinoma of unknown primary (CUP). Specimens of squamous cell CUP were reanalyzed. Human papillomavirus (HPV) status was determined
Patrick J Cimino et al.
Experimental and molecular pathology, 96(3), 310-315 (2014-04-08)
Viral pathogens have been implicated in the development of certain cancers including human papillomavirus (HPV) in squamous cell carcinoma and Epstein-Barr virus (EBV) in Burkitt's lymphoma. The significance of viral pathogens in brain tumors is controversial, and human cytomegalovirus (HCMV)
Fangli Cao et al.
International journal of clinical and experimental medicine, 7(10), 3430-3438 (2014-11-25)
The prognostic value of the HPV status in ESCC is much controversial, this study aimed to determine the prognostic importance of high-risk HPV and p16 in patients with ESCC. A total of 105 consecutive patients who underwent esophagectomy in 2008
Thomas Knösel et al.
Journal of clinical pathology, 67(7), 592-598 (2014-04-22)
p16(INK4a) is an important factor in carcinogenesis, and its expression is linked to oncogene-induced senescence. Very recently it was shown that upregulation and downregulation of p16 indicates a senescence barrier in the serrated route of colorectal cancer. However, in soft

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.