Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

SAB1404503

Sigma-Aldrich

Monoclonal Anti-TYMS antibody produced in mouse

clone 2B2, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

HsT422, MGC88736, TMS, TS, TSase

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2B2, monoclonal

Forma fisica

buffered aqueous solution

PM

antigen ~37.11 kDa

Reattività contro le specie

human

tecniche

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TYMS(7298)

Categorie correlate

Descrizione generale

The gene encoding thymidylate synthetase (TYMS) is localized on human chromosome 18p11.32.

Immunogeno

TYMS (AAH13919, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC

Azioni biochim/fisiol

Thymidylate synthetase (TYMS) has a role in DNA replication and thymidylate biosynthesis. It is also involved in cell survival and proliferation. TYMS takes part in folate metabolism. The protein methylates deoxyuridylate to deoxythymidylate.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Digital karyotyping identifies thymidylate synthase amplification as a mechanism of resistance to 5-fluorouracil in metastatic colorectal cancer patients.
Wang T, et al
Proceedings of the National Academy of Sciences of the USA, 101(9), 3089-3094 (2004)
Higher Tissue Levels of Thymidylate Synthase Determined by ELISA Are Associated with Poor Prognosis of Patients with Lung Cancer.
Shiina T, et al.
The Tohoku Journal of Experimental Medicine, 242(4), 303-316 (2017)
Thymidylate synthase gene polymorphisms as important contributors affecting hepatocellular carcinoma prognosis.
Wang X, et al.
Clinics and Research in Hepatology and Gastroenterology, 4193), 319-326 (2017)
Thymidylate synthase polymorphisms and risk of lung cancer among the Jordanian population: a case control study.
Qasem W A, et al.
Asian Pacific Journal of Cancer Prevention, 16, 8287-8292 (2015)
Yongjun Cha et al.
Anticancer research, 34(8), 4275-4280 (2014-07-31)
To identify immunohistochemical (IHC) features associated with sensitivity to lapatinib-plus-capecitabine (LX) and resistance to trastuzumab in human epidermal growth factor receptor (HER)-2-positive metastatic breast cancer. Expression levels of estrogen receptor, progesterone receptor, epidermal growth factor receptor, HER2, HER3/phosphorylated HER3 (pHER3)

Articoli

Neoplastic cells are highly dependent on the de novo synthesis of nucleotides to maintain sufficient pools to support DNA replication and the production of RNA.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.