SAB1404163

Monoclonal Anti-PRDX1 antibody produced in mouse

clone 4B11-D10, purified immunoglobulin, buffered aqueous solution

• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 4B11-D10, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~48 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso NCBI: BC007063
• N° accesso UniProt: Q06830
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PRDX1(5052)

Descrizione

Descrizione generale

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Three transcript variants encoding the same protein have been identified for this gene. (provided by RefSeq)

Immunogeno

PRDX1 (AAH07063, 1 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFHPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable