SAB1404011

Monoclonal Anti-KRAS antibody produced in mouse

clone 4F3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: C-K-RAS, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, KI-RAS, KRAS1, KRAS2, NS3
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 4F3, monoclonal
• Stato: buffered aqueous solution
• PM: antigen ~38.21 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_004985
• N° accesso UniProt: P01116
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... KRAS(3845)

Descrizione

Descrizione generale

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. (provided by RefSeq)

c-K-Ras or KRAS (Kirsten rat sarcoma-2 virus oncogene) is a small GTP-binding protein. The gene encoding it is localized on human chromosome 12p12.1. KRAS has two splice variants, that is, KRASA and KRASB (KRAS proto-oncogenes). Expression of KRASA is restricted to specific tissues whereas KRASB is ubiquitously expressed.

Immunogeno

KRAS (NP_004976, 16 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV

Applicazioni

Monoclonal Anti-KRAS antibody produced in mouse has been used in Western Blotting.

Azioni biochim/fisiol

KRAS (Kirsten rat sarcoma-2 virus oncogene) mutation has been associated with early rectal cancer and colorectal cancer. The protein has a role in signaling pathways.

KRAS (kirsten rat sarcoma-2 virus oncogene) upon binding to a cell surface receptor, including EGFR functions as a self-inactivating signal transducer by cycling from GDP- to GTP-bound states. Mutation in the gene leads to poor prognosis of early rectal cancer.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable