SAB1402821

Monoclonal Anti-IL11 antibody produced in mouse

clone 1F1, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: AGIF, IL-11
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1F1, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~31.61 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_000641
• N° accesso UniProt: P20809
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... IL11(3589)

Descrizione

Descrizione generale

The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. (provided by RefSeq)

Immunogeno

IL11 (NP_000632.1, 25 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDS

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable