SAB1402616

Monoclonal Anti-ELAC2 antibody produced in mouse

clone 1A2, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: ELC2, FLJ10530, FLJ36693, FLJ42848, HPC2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1A2, monoclonal
• Stato: buffered aqueous solution
• PM: antigen ~37 kDa
• Reattività contro le specie: human
• tecniche: direct immunofluorescence: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_018127
• N° accesso UniProt: Q9BQ52
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ELAC2(60528)

Descrizione

Descrizione generale

The protein encoded by this gene has a C-terminal domain with tRNA 3′ processing endoribonuclease activity, which catalyzes the removal of the 3′ trailer from precursor tRNAs. The protein also interacts with activated Smad family member 2 (Smad2) and its nuclear partner forkhead box H1 (also known as FAST-1), and reduced expression can suppress transforming growth factor-beta induced growth arrest. Mutations in this gene result in an increased risk of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogeno

ELAC2 (NP_060597.3, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
WALCSLLRSAAGRTMSQGRTISQAPARRERPRKDPLRHLRTREKRGPSGCSGGPNTVYLQVVAAGSRDSGAALYVFSEFNRYLFNCGEGVQRLMQEHKL

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable