SAB1401359

Monoclonal Anti-SEC13 antibody produced in mouse

clone 1G7, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: D3S1231E, SEC13L1, SEC13R, npp-20
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1G7, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; immunofluorescence: suitable; immunoprecipitation (IP): suitable
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_030673
• N° accesso UniProt: P55735
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SEC13(6396)

Descrizione

Descrizione generale

The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. (provided by RefSeq)

Immunogeno

SEC13 (NP_109598, 226 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNE

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable