SAB1400139
Anti-IL6 antibody produced in mouse
IgG fraction of antiserum, buffered aqueous solution
Sinonimo/i:
Anti-BSF2, Anti-HGF, Anti-HSF, Anti-IFNB2, Anti-IL6
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Prodotti consigliati
Origine biologica
mouse
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
IgG fraction of antiserum
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous solution
Reattività contro le specie
human
tecniche
immunofluorescence: suitable
western blot: 1 μg/mL
N° accesso UniProt
Condizioni di spedizione
dry ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... IL6(3569)
Categorie correlate
Descrizione generale
Human IL-6 (Interleukin-6) gene maps to chromosome 7p15. It is found to be mainly expressed in lymphoid and non-lymphoid cells, such as T-cells, B-cells, monocytes, fibroblasts, keratinocytes, endothelial cells and mesangium cells. It encodes a 184 amino acid protein that contains two potential N-glycosylation sites and four cysteine residues.
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. (provided by RefSeq)
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. (provided by RefSeq)
Immunogeno
IL6 (AAH15511, 1 a.a. ~ 212 a.a) full-length human protein.
Sequence
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sequence
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Azioni biochim/fisiol
IL-6 (Interleukin-6) is a proinflammatory cytokine that plays an important role in the maturation of B cells into antibody producing cells. It is also expressed by resting T-cells and induces IL-2 receptor and IL-2 production n mitogen-stimulated T cells and thymocytes. IL-6 functions in the activation and proliferation of T-cells. It participates in hematopoiesis by activating hematopoietic stem cells at the G0 stage to enter into the G1 phase. Increased levels of IL-6 and C-reactive protein have been observed in type-2 diabetes mellitus.
Stato fisico
Solution in phosphate buffered saline, pH 7.4
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Raccomandato
N° Catalogo
Descrizione
Determinazione del prezzo
Codice della classe di stoccaggio
10 - Combustible liquids
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
I clienti hanno visto anche
The biology of interleukin-6.
Hirano T.
Interleukins : molecular biology and immunology, 51, 153-180 (1992)
The biology of interleukin-6.
Hirano T.
INTERNATIONAL CONFERENCE OF COMPUTATIONAL METHODS IN SCIENCES AND ENGINEERING 2009:(ICCMSE 2009)., 51, 153-180 (1992)
A D Pradhan et al.
JAMA, 286(3), 327-334 (2001-07-24)
Inflammation is hypothesized to play a role in development of type 2 diabetes mellitus (DM); however, clinical data addressing this issue are limited. To determine whether elevated levels of the inflammatory markers interleukin 6 (IL-6) and C-reactive protein (CRP) are
Lorena Oróstica et al.
Reproductive sciences (Thousand Oaks, Calif.), 27(1), 290-300 (2020-02-13)
A pro-inflammatory environment is characteristic of obesity and polycystic ovary syndrome (PCOS). This environment through cytokines secretion negatively affects insulin action. Endometria from women with both conditions (obesity and PCOS) present high TNF-α level and altered insulin signaling. In addition
Hagen Maxeiner et al.
Journal of cellular physiology, 229(11), 1681-1689 (2014-03-14)
Cardiosphere-derived cells (CDCs) were cultured from human, murine, and rat hearts. Diluted supernatant (conditioned-medium) of the cultures improved the contractile behavior of isolated rat cardiomyocytes (CMCs). This effect is mediated by the paracrine release of cytokines. The present study tested
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.