HPA036528

Anti-WAC antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-BM-016, Anti-FLJ31290, Anti-MGC10753, Anti-PRO1741, Anti-WW domain containing adaptor with coiled-coil, Anti-Wwp4
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA036528

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunohistochemistry: 1:50- 1:200
• Sequenza immunogenica: RLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSYSPQENSH
• N° accesso UniProt: Q9BTA9
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... WAC(51322)

Descrizione

Descrizione generale

WAC (WW domain-containing adaptor protein) is present on human chromosome 10p12.1. It has a coiled coil domain and exists in four isoforms.

Immunogeno

WW domain containing adaptor with coiled-coil recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-WAC antibody produced in rabbit can be used for the detection of WAC protein in human embryonic kidney cells 293 lysate by immunoblotting. It may also be used for the detection of WAC proteins in HeLa cells by immunoblotting.

Azioni biochim/fisiol

WW domain-containing protein associates with Golgi matrix protein 120 and regulates generation of autophagosomes. During amino acid starvation, WAC also interacts with Golgi protein short coiled-coil protein (SCOC) to mediate autophagy. The coiled coil domain of WAC interacts with ubiquitin-protein ligase complex and aids in ubiquitination of histone H2B, favoring gene expression. WAC assists in the activation and entry of polo-like kinase into mitotic cycle. Microdeletions and de novo mutation in the WAC genome locus is associated with behavior disorders, developmental delay and facial abnormalities in children. Nonsense and frameshift mutations in the WAC gene results in a truncated protein product leading to hypotonia, interrupted development and dysmorphic facial features.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST80181

Stato fisico

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable