Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

HPA035241

Sigma-Aldrich

Anti-COLEC11 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-CL-K1, Anti-MGC3279

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.43

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Forma fisica

buffered aqueous glycerol solution

Reattività contro le specie

human

tecniche

immunohistochemistry: 1:200- 1:500

Sequenza immunogenica

INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... COLEC11(78989)

Descrizione generale

Collectin 11 (COLEC11) is member of C-type lectin family of proteins. The members of this family have collagen-like sequence and a calcium dependent carbohydrate recognition domain. They are predominantly expressed in kidney cells. These proteins also interact with extracellular DNA associated with apoptotic cells and biofilms. Collectin 11 is located on human chromosome 2p25.3 and shows two splice variants, resulting in two protein isoforms.

Immunogeno

collectin sub-family member 11 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-COLEC11 antibody produced in rabbit has been used for the detection of human collectin 11 in the ficolin-3 complex using microtiter plate assay.

Azioni biochim/fisiol

Collectin 11 (COLEC11) interacts with the antigenic part of the microbes to confer immune response against infections. Genetic polymorphism at promoter level affects collectin 11 expression. An amino acid variation alters its carbohydrate binding functionality. Collectin 11 is a potential host factor for preventing urinary schistosomiasis. Its allelic variation is more susceptible to the disease as the protein binds less effectively to the sugars. COLEC11 plays a key role in phagocytosis and cytokine production. Its level increases in disseminated intravascular coagulation. Mutation in COLLEC11 results in 3MC syndrome, a genetic disorder which is associated with abnormal facial features as a result of incomplete tissue development in the face and skull.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79013

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Mutations in lectin complement pathway genes COLEC11 and MASP1 cause 3MC syndrome
Rooryck C, et al.
Nature Genetics, 43(3), 197-197 (2011)
Collectin-11 is an important modulator of retinal pigment epithelial cell phagocytosis and cytokine production
Dong X, et al.
Journal of Innate Immunity, 9(6), 529-545 (2017)
Disease-causing mutations in genes of the complement system
Degn SE, et al.
American Journal of Human Genetics, 88(6), 689-705 (2011)
Elevated plasma CL-K1 level is associated with a risk of developing disseminated intravascular coagulation (DIC)
Takahashi K, et al.
Journal of thrombosis and thrombolysis, 38(3), 331-338 (2014)
Genetic variation of COLEC10 and COLEC11 and association with serum levels of collectin liver 1 (CL-L1) and collectin kidney 1 (CL-K1)
Bayarri-Olmos R, et al.
PLoS ONE, 10(2), e0114883-e0114883 (2015)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.