Tutte le immagini(7)

Key Documents

CdO/CdA

HPA019777

Anti-DAZL antibody produced in rabbit

Name: Anti-DAZL antibody produced in rabbit
Brand: SIGMA

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Sinonimo/i:

Anti-DAZ homolog, Anti-DAZ-like autosomal, Anti-Deleted in azoospermia-like, Anti-Deleted in azoospermia-like 1, Anti-SPGY-like-autosomal

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Tutte le immagini(7)

About This Item

Codice UNSPSC:

12352203

Numero Human Protein Atlas:

HPA019777

NACRES:

NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies^® Powered by Atlas Antibodies

Forma fisica

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

Sequenza immunogenica

HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLK

N° accesso UniProt

Q92904

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... DAZL(1618)

Categorie correlate

Anticorpi con validazione approfondita

Prestige Antibodies^® in collaborazione con Atlas Antibodies

Descrizione generale

DAZL (Deleted in azoospermia-like) is a SPGYLA encoded RNA binding protein belonging to the DAZ (deleted in azoospermia) gene family. In humans, it is expressed in germ cells and male gonad.

Immunogeno

Deleted in azoospermia-like recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-DAZL antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

DAZL (Deleted in azoospermia-like) plays an important role in gametogenesis of both males and females. It is crucially important for spermatogenesis. It regulates translation by binding to the 3′-UTR of mRNA, specifically recognizing GUU triplets. Mutations in this gene may cause male infertility.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74469

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Altered gene expression signature of early stages of the germ line supports the pre-meiotic origin of human spermatogenic failure.

S Bonache et al.

Andrology, 2(4), 596-606 (2014-05-08)

The molecular basis of spermatogenic failure (SpF) is still largely unknown. Accumulating evidence suggests that a series of specific events such as meiosis, are determined at the early stage of spermatogenesis. This study aims to assess the expression profile of

Kinked β-strands mediate high-affinity recognition of mRNA targets by the germ-cell regulator DAZL.

Huw T Jenkins et al.

Proceedings of the National Academy of Sciences of the United States of America, 108(45), 18266-18271 (2011-10-25)

A defect in germ-cell (sperm and oocyte) development is the leading cause of male and female infertility. Control of translation through the binding of deleted in azoospermia (DAZ)-like (DAZL) to the 3'-UTRs of mRNAs, via a highly conserved RNA recognition

The human autosomal gene DAZLA: testis specificity and a candidate for male infertility.

P H Yen et al.

Human molecular genetics, 5(12), 2013-2017 (1996-12-01)

The DAZ (Deleted in AZoospermia) and DAZLA (DAZ-like autosomal) genes may be determinants of male infertility. The DAZ gene on the long arm of the human Y chromosome is a strong candidate for the 'azoospermia factor' (AZF). Its role in

Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1.

S Tsui et al.

Genomics, 65(3), 266-273 (2000-06-17)

The human DAZ (deleted in azoospermia) gene family on the Y chromosome and an autosomal DAZ-like gene, DAZL1, encode RNA-binding proteins that are expressed exclusively in germ cells. Their role in spermatogenesis is supported by their homology with a Drosophila

A SPGY copy homologous to the mouse gene Dazla and the Drosophila gene boule is autosomal and expressed only in the human male gonad.

Z Shan et al.

Human molecular genetics, 5(12), 2005-2011 (1996-12-01)

We have isolated a series of human testis poly(A) cDNA clones by cross-hybridization to SPGY1, a Y gene homologous to DAZ. Their sequence analysis revealed an identical nucleotide composition in different 'full-length' clones, suggesting that all were encoded by the

Visualizza tutti i documenti correlati

Articoli

Stem Cell Markers and Antibodies

Stem cell markers, including embryonic stem cell, pluripotency, transcription factors, induced PSCs, germ cells, ectoderm, and endoderm markers.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.