Passa al contenuto
Merck
Tutte le immagini(7)

Documenti fondamentali

HPA017893

Sigma-Aldrich

Anti-RRP1B antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Sinonimo/i:

Anti-KIAA0179, Anti-Nnp1, Anti-PPP1R136, Anti-RRP1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

RNAi knockdown
Learn more about Antibody Enhanced Validation

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

Sequenza immunogenica

SISQLSFAEDISADEDDQILSQGKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAAPSLEQNRGREPEASGLKALKARVAEPGAEATSSTG

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

Descrizione generale

Ribosomal RNA processing 1B (RRP1B) is a 52kDa protein mainly located in the nucleolus. It possesses a nucleolar protein of 52kDa (NOP52) homology domain and an RVxF (Arg/Lys-Val/Ile-Xaa-Phe/Trp) motif. The gene encoding RRP1B is localized to human chromosome 21.

Immunogeno

Ribosomal RNA processing protein 1 homolog B recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-RRP1B antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. Anti-RRP1B antibody produced in rabbit has been used for co-immunoprecipitation.

Azioni biochim/fisiol

Ribosomal RNA processing 1B (RRP1B) is a metastasis modifier protein in breast cancer. It interacts with signal-induced proliferation-associated 1(SIPA1) and functions in the reduction of tumor growth. The expression of RRP1B regulates many extra cellular matrix (ECM) genes which are linked with tumor suppression. The protein has an effect on gene expression by regulating histone methylation and heterochromatinization. Along with bromodomain-containing protein 4 (Brd4), RRP1B transduces extracellular mechanistic signals to the nucleus.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73881

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

M Lee et al.
Oncogene, 33(14), 1818-1827 (2013-04-23)
RRP1B (ribosomal RNA processing 1 homolog B) was first identified as a metastasis susceptibility gene in breast cancer through its ability to modulate gene expression in a manner that can be used to accurately predict prognosis in breast cancer. However
Evolutionary breakpoints on human chromosome 21.
MT Davisson
Genomics, 78(1-2), 99-106 (2001)
Minnkyong Lee et al.
Molecular cancer research : MCR, 12(12), 1818-1828 (2014-08-06)
Overexpression of ribosomal RNA processing 1 homolog B (RRP1B) induces a transcriptional profile that accurately predicts patient outcome in breast cancer. However, the mechanism by which RRP1B modulates transcription is unclear. Here, the chromatin-binding properties of RRP1B were examined to
Delphine Chamousset et al.
Molecular biology of the cell, 21(23), 4212-4226 (2010-10-12)
A pool of protein phosphatase 1 (PP1) accumulates within nucleoli and accounts for a large fraction of the serine/threonine protein phosphatase activity in this subnuclear structure. Using a combination of fluorescence imaging with quantitative proteomics, we mapped the subnuclear localization
Santhoshi Rani Nanchari et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 36(2), 615-621 (2014-10-04)
Rrp1B (ribosomal RNA processing1 homolog B) is a novel candidate metastasis modifier gene in breast cancer. Functional gene assays demonstrated that a physical and functional interaction existing between Rrp1b and metastasis modifier gene SIPA1 causes reduction in the tumor growth

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.