Passa al contenuto
Merck
Tutte le immagini(6)

Documenti fondamentali

HPA017737

Sigma-Aldrich

Anti-PI3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-ESI, Anti-Elafin precursor, Anti-Elastase-specific inhibitor, Anti-Peptidase inhibitor 3, Anti-Protease inhibitor WAP3, Anti-SKALP, Anti-Skin-derived antileukoproteinase, Anti-WAP four- disulfide core domain protein 14

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

tecniche

immunohistochemistry: 1:2500- 1:5000

Sequenza immunogenica

KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMA

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PI3(5266)

Descrizione generale

Peptidase inhibitor 3 (PI3) is an endogenous serine protease inhibitor which is expressed in the epithelium of the gastrointestinal tract. It is a 9.9kDa protein consisting of 95 amino acids. PI3 belongs to the chelonianin family of proteins and the gene encoding it is localized on chromosome 20.

Immunogeno

Elafin precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-PI3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

Peptidase inhibitor 3 (PI3) has an inhibitory effect against various elastases and proteinases. It is a substrate of tissue transglutaminase 2 (TG-2), which has a cross-linking activity. In cardiovascular, respiratory and colonic inflammation, PI3 shows anti-inflammatory effects and barrier modifying properties. It is called an “alarm” antiproteinase, since it is secreted at the sites of inflammation by the same stimuli that causes initial inflammatory response. It has been shown that PI3 is overexpressed in basal-like breast cancer tumors and high-grade serous ovarian carcinoma. PI3 may also act as a marker of renal inflammation and injury.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70807

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Protease inhibitors derived from elafin and SLPI and engineered to have enhanced specificity towards neutrophil serine proteases
Zani ML, et al.
Protein Science, 18(3), 579-594 (2009)
Adam Clauss et al.
The Biochemical journal, 368(Pt 1), 233-242 (2002-11-06)
A locus containing 14 genes, encoding protein domains that have homology with whey acidic protein (WAP), has been identified in a region of 678 kb on human chromosome 20q12-13.1. Among them are genes of the known or postulated protease inhibitors
Paula Tejera et al.
American journal of respiratory cell and molecular biology, 51(2), 262-272 (2014-03-13)
Elafin (peptidase inhibitor 3 [PI3]) and its biologically active precursor, pre-elafin, are neutrophil serine proteinase inhibitors with an important role in preventing excessive tissue injury during inflammatory events. Recently, we reported an association between single-nucleotide polymorphism (SNP) rs2664581 in the
Jiani Wang et al.
PloS one, 15(4), e0231796-e0231796 (2020-04-15)
Antimicrobial peptide expression is associated with disease activity in inflammatory bowel disease (IBD) patients. IBD patients have abnormal expression of elafin, a human elastase-specific protease inhibitor and antimicrobial peptide. We determined elafin expression in blood, intestine, and mesenteric fat of
Heather J Galipeau et al.
The American journal of gastroenterology, 109(5), 748-756 (2014-04-09)
Elafin, an endogenous serine protease inhibitor, modulates colonic inflammation. We investigated the role of elafin in celiac disease (CD) using human small intestinal tissues and in vitro assays of gliadin deamidation. We also investigated the potential beneficial effects of elafin

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.