Passa al contenuto
Merck
Tutte le immagini(6)

Documenti fondamentali

HPA010593

Sigma-Aldrich

Anti-FOLH1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-Glutamate carboxypeptidase 2 antibody produced in rabbit, Anti-Glutamate carboxypeptidase II antibody produced in rabbit, Anti-Membrane glutamate carboxypeptidase antibody produced in rabbit, Anti-N-acetylated-α-linked acidic dipeptidase I antibody produced in rabbit, Anti-NAALADase I antibody produced in rabbit, Anti-Pteroylpoly-γ-glutamate carboxypeptidase antibody produced in rabbit, Anti-mGCP antibody produced in rabbit

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

tecniche

immunohistochemistry: 1:200- 1:500

Sequenza immunogenica

ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... FOLH1(2346)

Descrizione generale

FOLH1 (folate hydrolase 1) is a type II membrane protein, which is composed of a cytosolic domain, a transmembrane region, and an exoplasmic region. This protein exhibits both constitutive and induced internalization. It is an exopeptidase, which is Zn-dependent and is localized on the brush-border of the intestine.

Immunogeno

Glutamate carboxypeptidase 2 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-FOLH1 antibody produced in rabbit has been used for FACS (flourescence activated cell sorting)-based epitope mapping. Anti-FOLH1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

FOLH1 (folate hydrolase 1) is also known as prostate-specific membrane antigen (PSMA) and is over and strongly expressed in prostate cancer cells, including metastatic cells. This protein functions both as an N-acetylated a-linked acidic dipeptidase (NAALADase) and folate hydrolase (FOLH). In small intestine, it is responsible for the absorption of dietary polyglutamylated folates (folyl-n-γ-l-glutamic acid), which are the provitamin form of folic acid. Variants in this gene are linked with folate nutritional status and disease susceptibility, and its interaction with dietary natural vitamin C might be linked with the susceptibility to adenomatous polyp.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71680

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Jeong-Hwa Choi et al.
Asian Pacific journal of cancer prevention : APJCP, 16(10), 4383-4386 (2015-06-02)
The C1561T variant of the glutamate carboxypeptidase II (GCPII) gene is critical for natural methylfolylpolyglutamte (methylfolate) absorption, and has been associated with perturbations in folate metabolism and disease susceptibility. However, little is known on C1561T-GCPII as a risk factor for
He Ren et al.
Medical oncology (Northwood, London, England), 31(3), 857-857 (2014-01-31)
The aim of this study was to identify the expression of prostate-specific membrane antigen (PSMA) and analyze the correlation between PSMA with clinical characteristics in patients with pancreatic cancer. The expression of PSMA protein and mRNA was detected by immunohistochemistry
Toloudi Maria et al.
Journal of cancer research and therapeutics, 10(1), 133-141 (2014-04-26)
Prostate-specific membrane antigen (PSMA) is a widely used targeted molecule in prostate patients. The present research, attempts to support the hypothesis that PSMA expression in prostate cancer stem cell-like (CSC) cell populations may be correlated with nanog and other transcription
Michal Navrátil et al.
The FEBS journal, 281(14), 3228-3242 (2014-05-28)
In addition to its well-characterized role in the central nervous system, human glutamate carboxypeptidase II (GCPII; Uniprot ID Q04609) acts as a folate hydrolase in the small intestine, participating in the absorption of dietary polyglutamylated folates (folyl-n-γ-l-glutamic acid), which are
Alla Gabriella Wernicke et al.
APMIS : acta pathologica, microbiologica, et immunologica Scandinavica, 122(6), 482-489 (2013-12-07)
Prostate-specific membrane antigen (PSMA) has been found to be expressed in the tumor-associated neovasculature of multiple solid tumor types including breast cancers. However, thus far, the number of cases studied from some tumor types has been limited. In this study

Global Trade Item Number

SKUGTIN
HPA010593-100UL4061837125317
HPA010593-25UL4061842816569

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.