Passa al contenuto
Merck
Tutte le immagini(7)

Documenti fondamentali

HPA010022

Sigma-Aldrich

Anti-ALDH1A2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

ALDH1A2 Antibody - Anti-ALDH1A2 antibody produced in rabbit, Aldh1A2 Antibody, Anti-Aldehyde dehydrogenase family 1 member A2, Anti-RALDH 2, Anti-RALDH(II), Anti-RalDH2, Anti-Retinal dehydrogenase 2, Anti-Retinaldehyde-specific dehydrogenase type 2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

Sequenza immunogenica

VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... ALDH1A2(8854)

Descrizione generale

Aldehyde dehydrogenase 1 family, member A2 (ALDH1a2) gene is mapped to human chromosome 15q21.3. It belongs to the aldehyde dehydrogenase (ALDH) family. The product of ALDH1a2 gene is the enzyme retinaldehyde dehydrogenase type 2. The protein is found in few adult tissues, mainly in the urogenital tract.

Immunogeno

Retinal dehydrogenase 2 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-ALDH1A2 antibody produced in rabbit has been used in:
  • immunohistochemistry
  • immunofluorescence
  • western blotting
Anti-ALDH1A2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. Anti-ALDH1A2 antibody is also suitable for use in indirect immunofluorescence.

Azioni biochim/fisiol

Aldehyde dehydrogenase 1 family, member A2 (ALDH1a2), also known as retinaldehyde dehydrogenase type II (RALDH2), catalyzes the synthesis of all trans-retinoic acid from vitamin A. ALDH1a2 acts as a tumor suppressor. It plays a vital role in early embryonic and cardiac development. Variation in the ALDH1a2 gene expression may increase the risk of developing congenital heart disease (CHD). Reduced levels of ALDH1a2 has been observed in human prostate cancer patients.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71490

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Evaluation of protein biomarkers of prostate cancer aggressiveness
Rizzardi A E, et al.
BMC Cancer, 14(1), 244-244 (2014)
Duplication of the ALDH1A2 gene in association with pentalogy of Cantrell: a case report
Steiner MB, et al.
Journal of Medical Case Reports, 7(1), 287-287 (2013)
Frank-Mattias Schäfer et al.
Stem cell reports, 9(6), 2005-2017 (2017-11-28)
The bladder urothelium functions as a urine-blood barrier and consists of basal, intermediate, and superficial cell populations. Reconstructive procedures such as augmentation cystoplasty and focal mucosal resection involve localized surgical damage to the bladder wall whereby focal segments of the
Efterpi Kostareli et al.
The Journal of clinical investigation, 123(6), 2488-2501 (2013-05-03)
High-risk types of human papilloma virus (HPV) are increasingly associated with oropharyngeal squamous cell carcinoma (OPSCC). Strikingly, patients with HPV-positive OPSCC are highly curable with ionizing radiation and have better survival compared with HPV-negative patients, but the underlying molecular mechanisms
Functional characterization of the osteoarthritis genetic risk residing at ALDH1A2 identifies rs12915901 as a key target variant
Shepherd C, et al.
Arthritis and Rheumatism, 70(10), 1577-1587 (2018)

Global Trade Item Number

SKUGTIN
HPA010022-100UL4061837125188
HPA010022-25UL4061842816286

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.