HPA007865

Anti-BCAN antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Brain-enriched hyaluronan-binding protein antibody produced in rabbit, Anti-Brevican core protein precursor antibody produced in rabbit, Anti-Protein BEHAB antibody produced in rabbit
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA007865

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• tecniche: immunohistochemistry: 1:200-1:500
• Sequenza immunogenica: ACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFR
• N° accesso UniProt: Q96GW7
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... BCAN(63827)

Descrizione

Descrizione generale

BCAN (brevican) gene encodes a chondroitin sulfate proteoglycan that is a member of the aggrecan/versican family. The gene is mapped to human chromosome 1q31. The N-terminal region contains a hyaluronic acid-binding domain. An epidermal growth factor-like repeat, a lectin-like and a complement regulatory protein-like domains are present at the C-terminal region. It is the smallest core protein in this family and is expressed in the developing and adult brain. It is expressed in primary cerebellar astrocytes but not in neurons. The core protein has a molar mass of 145kDa and the N terminally truncated form has a molar mass of 80Da.

Immunogeno

Brevican core protein precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-BCAN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)
Western Blotting (1 paper)

Azioni biochim/fisiol

Brevican is a proteoglycan that functions in the formation of extracellular matrix in the brain. Its expression in the brain increases as the brain develops. It plays a role in the maintenance of the extracellular environment of mature brain. The proteoglycans function in cell-cell and cell-matrix interactions in the brain.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71572

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)