HPA006880
Anti-SCG3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinonimo/i:
Anti-Secretogranin III antibody produced in rabbit, Anti-Secretogranin-3 precursor antibody produced in rabbit, Anti-SgIII antibody produced in rabbit
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Nome Commerciale
Prestige Antibodies® Powered by Atlas Antibodies
Stato
buffered aqueous glycerol solution
Reattività contro le specie
human
Convalida avanzata
recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
tecniche
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
Sequenza immunogenica
LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... SCG3(29106)
Immunogeno
Secretogranin-3 precursor recombinant protein epitope signature tag (PrEST)
Applicazioni
Anti-SCG3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Azioni biochim/fisiol
SCG3 (Secretogranin III) is a secretory protein belonging to the multifunctional granin family. It is widely distributed in many tissues specifically in the brain. It is transmitted from the cell through trans-Golgi network (TGN). SCG3 is majorly involved in two functions; firstly, the storage and transportation of neurotransmitters, and secondly, biogenesis of secretory granule. It also generates peptide hormones through the regulated secretory pathway. It has been reported that SCG3 may participate in the apoptotic signaling pathway. It has also been postulated that SCG3 may play a role in the neuroendocrine pathway which proves pathological implications in the Parkinson′s disease (PD).
Caratteristiche e vantaggi
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST70128
Stato fisico
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Note legali
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Dispositivi di protezione individuale
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Sonia Paco et al.
Cerebral cortex (New York, N.Y. : 1991), 20(6), 1386-1397 (2009-11-07)
Astrocytes release peptide and nonpeptide transmitters that influence neuronal development, function, and plasticity. However, the molecular components of the astroglial secretory pathways in vivo are largely unknown. Here, we analyze in astrocytes the production, expression regulation, trafficking, and release of
Yi-Ping Rong et al.
Sheng wu hua xue yu sheng wu wu li xue bao Acta biochimica et biophysica Sinica, 34(4), 411-417 (2002-07-06)
We have cloned a new member of the granin family, termed human secretogranin III (SgIII), that encodes 468 amino acid residues. The human SgIII protein possesses an N-terminal signal peptide, seven dibasic sites, and the repeated DSTK sequences. These structure
Fengrui Li et al.
Journal of neuroscience research, 90(12), 2237-2246 (2012-09-19)
The neurotoxins paraquat (PQ) and dopamine (DA or 6-OHDA) cause apoptosis of dopaminergic neurons in the substantia nigra pars compacta (SNpc), reproducing an important pathological feature of Parkinson's disease (PD). Secretogranin III (SCG3), a member of the multifunctional granin family
Justyna Leja et al.
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, 22(2), 261-272 (2008-10-28)
The gene expression profile of metastasizing serotonin-producing neuroendocrine carcinomas, which arise from enterochromaffin cells in the jejunum and ileum, is still largely unknown. The aim of this study was to identify genes and proteins, which are preferentially expressed by neuroendocrine
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.