HPA003324
Anti-SLC16A1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinonimo/i:
Anti-MCT 1, Anti-Monocarboxylate transporter 1, Anti-Solute carrier family 16 member 1
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Nome Commerciale
Prestige Antibodies® Powered by Atlas Antibodies
Stato
buffered aqueous glycerol solution
Reattività contro le specie
human
Convalida avanzata
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
tecniche
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
Sequenza immunogenica
PTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGF
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... SLC16A1(6566)
Descrizione generale
Solute carrier family 16, member 1 (SLC16A1) gene spanning 44kb is mapped to human chromosome 1p13.2-p12. The encoded protein MCT1, belongs to the monocarboxylate transporter (MCT) family.
Immunogeno
Monocarboxylate transporter 1 recombinant protein epitope signature tag (PrEST)
Applicazioni
Anti-SLC16A1 antibody produced in rabbit has been used in immunostaining and immunoblotting.
Anti-SLC16A1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Azioni biochim/fisiol
Solute carrier family 16, member 1(SLC16A1) gene encodes a proton-coupled monocarboxylate transporter that catalyzes the transport of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids, acetoacetate, β-hydroxybutyrate and acetate.The protein is essential for normal assimilation of nutrients. It is coexpressed with lactate dehydrogenase B (LDHB) in basal-like breast cancer. It is found to be expressed on tumor cells. It serves as a potential therapeutic target for high-risk neuroblastomas. Mutation in SLC16A1 causes profound ketoacidosis characterized with imbalanced hepatic production and extrahepatic utilization of ketone bodies.
Caratteristiche e vantaggi
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST86072
Stato fisico
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Note legali
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Scegli una delle versioni più recenti:
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Peter M van Hasselt et al.
The New England journal of medicine, 371(20), 1900-1907 (2014-11-13)
Ketoacidosis is a potentially lethal condition caused by the imbalance between hepatic production and extrahepatic utilization of ketone bodies. We performed exome sequencing in a patient with recurrent, severe ketoacidosis and identified a homozygous frameshift mutation in the gene encoding
Jun Fang et al.
Molecular pharmacology, 70(6), 2108-2115 (2006-09-27)
Neuroblastomas produce high amounts of lactic acid and upregulate the H(+)-linked monocarboxylate transporter isoform 1 (MCT1/SLC16A1). We found elevated MCT1 mRNA levels in fresh neuroblastoma biopsy samples that correlated positively with risk of fatal disease and amplification of the "proto-oncogenic"
Genetic variations in the MCT1 (SLC16A1) gene in the Chinese population of Singapore
Lean CB and Lee EJD
Drug Metabolism and Pharmacokinetics, 24(5), 469-474 (2009)
I Tamai et al.
Biochemical and biophysical research communications, 214(2), 482-489 (1995-09-14)
A molecular mechanism for the intestinal monocarboxylic acid transport was characterized by using a proton/monocarboxylate transporter, MCT1, in Chinese hamster ovary (CHO) cells, first found by Garcia et al. (Cell, 76, 865-873, 1994). Northern blotting analysis showed that MCT1-isomers exist
Timo Otonkoski et al.
American journal of human genetics, 81(3), 467-474 (2007-08-19)
Exercise-induced hyperinsulinism (EIHI) is a dominantly inherited hypoglycemic disorder characterized by inappropriate insulin secretion during anaerobic exercise or on pyruvate load. We aimed to identify the molecular basis of this novel disorder of beta -cell regulation. EIHI mapped to chromosome
Articoli
Drug Transport
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA003324-100UL | 4061837134456 |
| HPA003324-25UL | 4061842813513 |
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.