Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

AV54286

Sigma-Aldrich

Anti-EPHX1 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-EPHX, Anti-EPOX, Anti-Eoxide hydrolase 1, microsomal (xenobiotic), Anti-MEH

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

53 kDa

Reattività contro le specie

horse, goat, guinea pig, rat, human, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_001129490

N° accesso UniProt

P07099

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... EPHX1(2052)

Categorie correlate

Immunogeno

Synthetic peptide directed towards the middle region of human EPHX1

Applicazioni

Anti-EPHX1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Azioni biochim/fisiol

EPHX1 [Epoxide hydrolase 1, microsomal (xenobiotic)] gene encodes a biotransformation enzyme that metabolizes arene and aliphatic epoxides to more water-soluble trans-dihydrodiol derivatives. It also plays a pivotal role in carcinogen metabolism and facilitates the sodium-dependent uptake of bile acids into hepatocytes. Mutation in EPHX1 gene results in preeclampsia, which causes increased epoxide hydrolase activity or epoxide hydrolase deficiency.

Sequenza

Synthetic peptide located within the following region: CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

J Lundbom et al.
Scandinavian journal of thoracic and cardiovascular surgery, 26(3), 187-192 (1992-01-01)
Factors influencing the effect on employment status were investigated in 250 patients (males: females 224:26) who underwent coronary artery bypass surgery between March 1983 and November 1985. The median age at operation was 57.9 (range 36.6-69.4) years and the median
Jaana Laasanen et al.
European journal of human genetics : EJHG, 10(9), 569-573 (2002-08-13)
This study determined whether genetic variability in exons 3 and 4 of the microsomal epoxide hydrolase gene jointly modifies individual preeclampsia risk. The study also determined whether genetic variability in the gene encoding for microsomal epoxide hydrolase (EPHX) contributes to
C Hassett et al.
Human molecular genetics, 3(3), 421-428 (1994-03-01)
Human microsomal epoxide hydrolase (mEH) is a biotransformation enzyme that metabolizes reactive epoxide intermediates to more water-soluble trans-dihydrodiol derivatives. We compared protein-coding sequences from six full-length human mEH DNA clones and assessed potential amino acid variation at seven positions. The

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.