AV48984

Anti-PCMTD1 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-FLJ10883, Anti-Protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 41 kDa
• Reattività contro le specie: mouse, guinea pig, rat, bovine, dog, human, rabbit, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_443169
• N° accesso UniProt: Q96MG8
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... PCMTD1(115294)

Descrizione

Descrizione generale

Mutations in Protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1 (PCMTD1) gene are associated with primary angle closure glaucoma (PACG).

Immunogeno

Synthetic peptide directed towards the middle region of human PCMTD1

Applicazioni

Anti-PCMTD1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Sequenza

Synthetic peptide located within the following region: TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable