Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

AV48205

Sigma-Aldrich

Anti-GOT1 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-GIG18, Anti-Glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

46 kDa

Reattività contro le specie

horse, human, rabbit, goat, mouse, rat, guinea pig, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... GOT1(2805)

Descrizione generale

Glutamic-oxaloacetic transaminase 1, soluble (GOT1) is an enzyme that is involved in the metabolism of amino acids. It is also involved in tricarboxylic acid and area cycles. Studies have reported that GOT1 plays a role in vesicle formation from the ER. GOT1 has been xenografted to nude mice for radiotherapy studies.
Rabbit Anti-GOT1 antibody recognizes human, mouse, rat, bovine, pig, and chicken GOT1.

Immunogeno

Synthetic peptide directed towards the N terminal region of human GOT1

Applicazioni

Rabbit Anti-GOT1 antibody is suitable for western blot applications at a concentration of 5μg/ml.

Azioni biochim/fisiol

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequenza

Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Ola Nilsson et al.
Annals of the New York Academy of Sciences, 1014, 275-279 (2004-05-22)
Malignant carcinoid tumors express high numbers of somatostatin receptors. Radiation therapy using labeled somatostatin analogs is a novel treatment modality for these tumors. We have analyzed the biokinetics and therapeutic effect of radiolabeled somatostatin analog on a human midgut carcinoid
Andrés Lorente-Rodríguez et al.
Journal of cell science, 122(Pt 10), 1540-1550 (2009-04-23)
Yip1p belongs to a conserved family of membrane-spanning proteins that are involved in intracellular trafficking. Studies have shown that Yip1p forms a heteromeric integral membrane complex, is required for biogenesis of ER-derived COPII vesicles, and can interact with Rab GTPases.
Tatsunori Suzuki et al.
Cancer gene therapy (2021-04-10)
Mutational activation of the KRAS gene occurs in almost all pancreatic ductal adenocarcinoma (PDAC) and is the earliest molecular event in their carcinogenesis. Evidence has accumulated of the metabolic reprogramming in PDAC, such as amino acid homeostasis and autophagic flux.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.